SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316067.Geob_3254 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  316067.Geob_3254
Domain Number - Region: 48-71,107-133
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00228
Family Pre-dockerin domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316067.Geob_3254
Sequence length 172
Comment (Geobacter FRC 32)
Sequence
MQIKKGYLIFLLLFMWLILTGCGSSSSDAQGTSSLPTNESKVTATQGVWGNVWFWTGNFM
PSVAGTTNSSGNITPVVREIFVYKATTISDVMPYSLGEFYSYIPSELVAKTSSDETGFFQ
VTLSPGTYSIFVKEGSAFYANKFDGQGRVNPVEVVPGAVTKLQIDINYQATF
Download sequence
Identical sequences B9M4R3
316067.Geob_3254 gi|222056336|ref|YP_002538698.1| WP_012648325.1.88144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]