SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316067.Geob_3590 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316067.Geob_3590
Domain Number 1 Region: 314-471
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.14e-31
Family HD domain 0.015
Further Details:      
 
Domain Number 2 Region: 209-305
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000138
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316067.Geob_3590
Sequence length 521
Comment (Geobacter FRC 32)
Sequence
MKIDMITIVLAVITAAVGFLIGNLLRKKSSDAIVASAEELAAKMLEESKRQAETITKEAT
LQAKDVVYQAKAEFERETKEKRRDLQALEKRLQQKEENLDKKVNLLDQRDAEFIKREQTL
VTKEQGVAQKEEKLNQLISEERTRLENISGMTAVEAKKILMETMENEAKLDAAKRIKAIE
EEAKETADKKSKEIMALAIQRYAGEYVAERTVSVVALPSDEMKGRIIGREGRNIRALEAA
TGIDLIIDDTPEAVILSGFNPVRREVAKLSLEKLIADGRIHPGRIEEVVAKAEEEIEQAM
KEAGEQAAFDLGVHGIHPEILKLIGRLKYRTSYSQNVYQHSLEVAFLCGIMASELGINVK
QAKRAGLLHDLGKAVDHEVEGSHAVIGAELAKKYGESPKIIHAIMAHHEDEKPATVLAVL
VQAADALSGARPGARREMMETYVKRLDDLERIASSFSGVTNSFAIQAGREIRVMVASEEV
SDERSLILAKDIAKKIETEMTYPGQIKVNVIRETRATEYAR
Download sequence
Identical sequences B9M6E3
316067.Geob_3590 WP_012648659.1.88144 gi|222056670|ref|YP_002539032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]