SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_3037 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_3037
Domain Number 1 Region: 32-145
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000102
Family CalX-beta domain 0.011
Further Details:      
 
Domain Number 2 Region: 163-282
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000051
Family Collagen-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_3037
Sequence length 285
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MKFARILILLLLIHGILPQASFANPDAPTAATLAWSSAYASTAEGIDVWLRINVVGAAPT
DDVNLKFIYQTFQQTAEYNHDYEPTNWPSGTKGAIVGNNRVAYIKIHIKKNDYPEPTETF
QVELRSDAANTVISGPARVTVTIRRSRLMNPIAGIMESCVNGGEPNNDFPASAGQIAVNG
GWCNTSFETEAVRDVDYYHVEQSTAGNITIRLENTTPDQHDLNIYLYYRDVQEGYKLYLQ
STNPGQQAEVISNAPIAANTNYLIAVYWASDTGDKIPTYRLSVSR
Download sequence
Identical sequences A9B4V2
gi|159899556|ref|YP_001545803.1| 316274.Haur_3037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]