SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_3283 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_3283
Domain Number 1 Region: 108-221
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 9.52e-30
Family Single-domain sulfurtransferase 0.021
Further Details:      
 
Domain Number 2 Region: 9-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.3e-21
Family ArsR-like transcriptional regulators 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_3283
Sequence length 226
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MELSQKRQFKDALYEQFARISRALANPHRLELLDLLTQGERTVEDLANETALSIANASQH
LQTLRAAQLVSVRREGLYAYYRLANASVQALWLSLRQVGESQLADVQAVVQHFLADRSQY
QSISISDLYQRIEQQDVVLLDVRPSNEFAVAHLPQARSIPITELSQRLAELAPDQPIVAY
CRGPYCLFADEAVATLSQRGFEVYRLDGGIVEWQAHGFALAQETAK
Download sequence
Identical sequences A9B7Y7
gi|159899801|ref|YP_001546048.1| 316274.Haur_3283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]