SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_3880 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_3880
Domain Number 1 Region: 300-495
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.62e-47
Family Ribonuclease PH domain 1-like 0.0000178
Further Details:      
 
Domain Number 2 Region: 7-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-47
Family Ribonuclease PH domain 1-like 0.0000198
Further Details:      
 
Domain Number 3 Region: 456-556
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.54e-28
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 4 Region: 140-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-25
Family Ribonuclease PH domain 2-like 0.0017
Further Details:      
 
Domain Number 5 Region: 617-702
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.11e-22
Family Cold shock DNA-binding domain-like 0.0007
Further Details:      
 
Domain Number 6 Region: 560-637
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.28e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 7 Region: 240-326
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000000288
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_3880
Sequence length 777
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MSEQQVHSVTVELAGRPLTIEAGRVAQLANGAVLVRYGDTVLLAAVTASAEPRDGIDFFP
LTVDYEEKMYAAGKIPGSFFKREGRPTETAILTSRLTDRPLRPLFPKGYYNDVQVSITTL
STDQVNDPGPLAIIGASAALVISDIPFAAPVGAVQMGHIDGVFAVNPVMGLMENSRLDLV
VAGTSEAVMMVEASAYELTEAEMLEAVKRGHEAMQAVIQAQLELAEKCGKPKKEFVAPVV
DTSLQDEIKAWMGNRFLQALNNSDKAAREAATDSLRTDVLEQFSAGVAEEELAARVKAVT
KNYDALVKDEVRASILEQGIRVDGRKVNEIRPIAVDVGVLPRVHGSGLFTRGQTQVLTVA
TLGSPGDEQRLDDLGIETTRHYMHHYNFPAFSTGEARPSRGPRRRDIGHGKLAERALVPV
LPEKDKFPYTMRLVSEVLASNGSSSMASVCGSSLALMDAGVPIKAPVAGVAMGLITGKEA
GQFSVLTDIQGLEDALGDMDFKVAGTTAGITALQMDIKTTGITYEIMQQAFEQARQGRVF
ILDKMNEIINTARNDISQFAPRIITLQIDPSKIGALIGPGGKTIRSIIEQTGAQIDVEDD
GRVFVTTPDADGARMAQSLIEGLTREAKVGEIFTGKVVRIMPYGAFVNVLPGKDGMVHVS
ELDEKRVENVEDVVKIGDELTVMVIDVEPGTGKLSLSRRAILTGETAEQRKSSSSKGGPR
GGGGGGDRGPRPGGDRGPRPEGDRGPRPEGDRPREGGDRGPRPGNGGNDRRGGGFRG
Download sequence
Identical sequences A9B8G1
gi|159900395|ref|YP_001546642.1| 316274.Haur_3880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]