SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_4067 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_4067
Domain Number 1 Region: 4-74
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 2.35e-20
Family F1F0 ATP synthase subunit C 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_4067
Sequence length 77
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MTDTGARLLAAALAIGLAAIGPGIGVGLLVAGALQAIARNPETEGSIRTNMFVGIALTEG
LAIFGLVISLLIGFGVL
Download sequence
Identical sequences A9AVU9
316274.Haur_4067 gi|159900580|ref|YP_001546827.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]