SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316275.VSAL_I2628 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316275.VSAL_I2628
Domain Number 1 Region: 134-298
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.33e-58
Family NadC C-terminal domain-like 0.0000011
Further Details:      
 
Domain Number 2 Region: 18-132
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 7.46e-32
Family NadC N-terminal domain-like 0.00002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316275.VSAL_I2628
Sequence length 299
Comment (Aliivibrio salmonicida LFI1238)
Sequence
MDLSMIKTHDSDSRLEYLKQQLPAEITRAVADTLREDLGGTLDVSADITASLISEDSQSV
ATIITREHGVFCGKMWAEEVFKQLGGTVTIEWHVEDGDKVKPNQTLCTLSGPSRALLTGE
RNAMNFIQTLSGCSTITATYAEKIAHTKCRLLDTRKTIPGLRSALKYAVACGGGYNHRIG
VFDAYLIKENHIIACGGIEKAISTAKELNPGKPVEVETESLEELQQAIDAGADIIMLDNF
TTDMMREAVKLNAGRAALENSGNVTLDTIAEYAETGVNYISVGALTKHLTAMDLSMRFK
Download sequence
Identical sequences B6ELF9
316275.VSAL_I2628 WP_012551084.1.35969 gi|209696037|ref|YP_002263967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]