SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316278.SynRCC307_0543 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316278.SynRCC307_0543
Domain Number 1 Region: 302-496
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.47e-46
Family Ribonuclease PH domain 1-like 0.00000751
Further Details:      
 
Domain Number 2 Region: 6-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-43
Family Ribonuclease PH domain 1-like 0.000025
Further Details:      
 
Domain Number 3 Region: 143-228
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.44e-26
Family Ribonuclease PH domain 2-like 0.0024
Further Details:      
 
Domain Number 4 Region: 459-557
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.62e-26
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 5 Region: 615-701
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.14e-21
Family Cold shock DNA-binding domain-like 0.00059
Further Details:      
 
Domain Number 6 Region: 561-638
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000518
Family Eukaryotic type KH-domain (KH-domain type I) 0.0051
Further Details:      
 
Domain Number 7 Region: 237-328
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000575
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316278.SynRCC307_0543
Sequence length 719
Comment (Synechococcus RCC307)
Sequence
MQGETRSISFDGREIRLTTRRYAPQAGGSVLIECGDTAVLVTATRANGREGIDFLPLTCD
YEERLYAAGRIPGSFMRRESRPPERATLACRLIDRPIRPLFPSWMRDDLQIVATVMSVDE
RVPPDVLAVTGASLATLLAKIPFYGPMAAVRVGLLGDDFILNPSYREIERSELDLVVAGT
AEGVVMVEAGAQQLPEEDMIEAIDFGYEAVLELIRHQKETIAELGIEQVVPEKPAEDTTV
PDYLAKQCTKDIGAVLSQFTLTKAERDSQLDSIKAKAAEAIAALKETDAVRAAVSSNGKL
LGNSFKALTKSMMRAQIVKDGKRVDGRSLDQVRPISAAAGVLPKRVHGSGLFQRGLTQVL
STATLGTPSDAQEMDDLNPSNEKHYLHHYNFPPYSVGETRPMRSPGRREIGHGALAERAL
LPVLPPKESFPYVLRVVSEVLSSNGSTSMGSVCGSTLALMDAGVPIAAPVAGAAMGLIRE
GSEVRVLTDIQGIEDFLGDMDFKVAGTEKGITALQMDMKITGLAMKTIGEAVTQARPARL
HILEKMLEALDKPRDTMSPHAPRRLSFRIDPELIGTVIGPGGRTIKGITERTNTKIDIED
TGIVTVASHDGAAAEEAQKIIEGLTRRVSEGEYFDGKVTRVIPIGAFVEILPGKEGMIHI
SQLSDQRVEKVEDVVNVGDEVRVRVREIDNRGRINLTLRGVPQDGSDPQPTVILPIGES
Download sequence
Identical sequences A5GRD7
316278.SynRCC307_0543 gi|148241642|ref|YP_001226799.1| WP_011934961.1.22971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]