SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316278.SynRCC307_1650 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  316278.SynRCC307_1650
Domain Number - Region: 8-148
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.0589
Family Diacylglycerol kinase-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316278.SynRCC307_1650
Sequence length 168
Comment (Synechococcus RCC307)
Sequence
MVLDRLIRAAGWLGRWALLLMIAIGAWNVVGRYLGLALGLSLSSNALIEAQWFLFDVAFL
LGLAYTLKQRGHVRIDILLNRQSTRRQLQLELLGTLVLLLPFALTVLVVSLEPTLQSWLL
LEASPDPGGLPRYLAKTLVPLGFLLLALQGIREAVALRQQLRRGGGQS
Download sequence
Identical sequences A5GUJ4
316278.SynRCC307_1650 gi|148242749|ref|YP_001227906.1| WP_011936067.1.22971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]