SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316279.Syncc9902_1794 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316279.Syncc9902_1794
Domain Number 1 Region: 300-496
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.81e-47
Family Ribonuclease PH domain 1-like 0.00000862
Further Details:      
 
Domain Number 2 Region: 5-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.99e-43
Family Ribonuclease PH domain 1-like 0.0000202
Further Details:      
 
Domain Number 3 Region: 459-557
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.44e-27
Family Ribonuclease PH domain 2-like 0.0000859
Further Details:      
 
Domain Number 4 Region: 143-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.98e-27
Family Ribonuclease PH domain 2-like 0.002
Further Details:      
 
Domain Number 5 Region: 615-700
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.11e-19
Family Cold shock DNA-binding domain-like 0.00063
Further Details:      
 
Domain Number 6 Region: 561-635
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000152
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316279.Syncc9902_1794
Sequence length 721
Comment (Synechococcus CC9902)
Sequence
MQGKTQSISFDGREIRLTTGRFAPQAGGSVLVECGDTAVLVTATRSKGRDGIDFLPLICD
YEERLYAAGRIPGSYMRREARPPERATLTCRLIDRPMRPLFPSWMRDDLQVVATCLSLDE
RVPSDVLAVTGASIATLLAGIPFNGPMAAVRVGLLGDDFVLNPSYREIERGDLDLVVAGT
ADGVVMVEAGANQLPEGDVIEAIDFGYEAIQELIKAQETLLKDLGIKQVKPEAPKEDTTV
PAYLEKQCTKAISAVLSKFEQSKEDRDNGLEAVKADAAEAIAALKEDDAVRQAVSSSSKL
LGNSFKALTKKLMRQQILKDGKRVDGRGLDEVRQISAMAGVLPRRVHGSGLFQRGLTQVL
STATLGTPSDAQEMDDLHPNTEKLYLHHYNFPPYSVGETRPMRSPGRREIGHGALAERAI
LPVLPEKDTFPYVVRVVSEVLSSNGSTSMGSVCGSTLALMDAGVPLKAPVSGAAMGLIKE
GKDIKILTDIQGIEDFLGDMDFKVAGSEKGITALQMDMKITGLPVKVMAEAVNQARPARL
HILEKMLEAIDKPRETLSPHAPRLLSFRIDPELIGTVIGPGGRTIKGITERTNTKIDIED
SGIVTIASHDGAAAEEAQKIIEGLTRKVNEGEMFSGSITRIIPIGAFVEILPGKEGMIHI
SQLSEARVEKVEDVVKVGDEVTVRVREIDNRGRINLTLRGVPQSGESTEVEPQPTPVAPL
S
Download sequence
Identical sequences Q3AV44
WP_011360557.1.34419 316279.Syncc9902_1794 gi|78185360|ref|YP_377795.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]