SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 317025.Tcr_0437 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  317025.Tcr_0437
Domain Number - Region: 40-84
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.00196
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 317025.Tcr_0437
Sequence length 91
Comment (Thiomicrospira crunogena XCL-2)
Sequence
MSELQSVHNYYERPVFNHIQENYLNVGLTENQLADMACIALNRIAPRYIRHDIDMSFYMS
SEEYQEIQTRVEKAVKKAFKKVKKLDGLERT
Download sequence
Identical sequences Q31IJ0
317025.Tcr_0437 gi|78484782|ref|YP_390707.1| WP_011369858.1.20162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]