SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 317025.Tcr_0711 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  317025.Tcr_0711
Domain Number 1 Region: 3-121,187-305
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 6.54e-77
Family FabD-like 0.000000512
Further Details:      
 
Domain Number 2 Region: 127-194
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 1.7e-16
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 317025.Tcr_0711
Sequence length 307
Comment (Thiomicrospira crunogena XCL-2)
Sequence
MSYAFVFPGQGSQSLGMMADMAATHPVVKTTFDEASAALGYDLWDIIQNGPEDKLNQTDI
TQPAMLTSGIATWRALAEQKELSPAFLAGHSLGEYSALVAAGVMSLSQGVKLVAERGRLM
QSAVPAGEGAMAAVLGLEDQQIIDICAQQSGVVEAVNFNSPGQVVIAGEKKAVDAALPAF
EAAGAKRVVLLAVSVPSHCSLMKPAAEALAKELEGMSLNAPSIPVLHNASVESYQDEASI
KHALVEQLYRPVQWVKTIEKMKENGVESLYELGPGKVLMGLNRRIDRKMGMQAVYDSATL
TASLETL
Download sequence
Identical sequences Q31HR6
317025.Tcr_0711 gi|78485056|ref|YP_390981.1| WP_011370134.1.20162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]