SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 317025.Tcr_0753 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  317025.Tcr_0753
Domain Number 1 Region: 24-90
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000216
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 317025.Tcr_0753
Sequence length 93
Comment (Thiomicrospira crunogena XCL-2)
Sequence
MSENTIELPENLTIHHIEEEFGNLKIAFQSDAETYKLVAGNVESIDTSGLQALLALIKSA
MANQKKIQWDSPTDTLKMGAEKLGLTEKLGLTS
Download sequence
Identical sequences Q31HM4
317025.Tcr_0753 gi|78485098|ref|YP_391023.1| WP_011370176.1.20162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]