SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 317025.Tcr_1129 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  317025.Tcr_1129
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.59e-50
Family Ribonuclease PH domain 1-like 0.0000161
Further Details:      
 
Domain Number 2 Region: 296-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.44e-45
Family Ribonuclease PH domain 1-like 0.00000955
Further Details:      
 
Domain Number 3 Region: 144-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.79e-28
Family Ribonuclease PH domain 2-like 0.0023
Further Details:      
 
Domain Number 4 Region: 452-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.68e-28
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 5 Region: 557-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.83e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 6 Region: 622-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.98e-20
Family Cold shock DNA-binding domain-like 0.00022
Further Details:      
 
Domain Number 7 Region: 238-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 5.23e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 317025.Tcr_1129
Sequence length 694
Comment (Thiomicrospira crunogena XCL-2)
Sequence
MSKFIKSFQYGKHEVRFETGEIARQADGAVMVAMGDTQLLVTVVGAKNAKAGQDFFPLTV
QYQEKAYAAGRIPGGFLKREGRPSEKETLTSRLIDRPIRPLFPKGFMNEVQVIATVVSLD
PEIGTEVPAMLGTSAALSISGIPFDGPIGAAVVGYKDNDYILNPSSQELQESDLELSVAG
TSDAVLMVESEASELSEEIMLGAVMFGHEQMQVAIDAIKELKAEVGKPAWNWEAAEEDID
LKTKVFDAIRSDIEAAYDIADKMDRYAAIDAAKTKVMEALAATEENPEGYDAGDIEKMVG
KLQKEIVRGRIIAGEPRIDGRDTQTIRSIDCQVGILPKVHGSALFTRGETQAIVVTTLGT
EKDAKMVDDLTGSYNDRFMLHYNFPPYSVGECGRVGSPGRREIGHGMLARRGVAALLPTA
DEFPYTIRVVSEITESNGSSSMATVCGTSMSLMHAGVPLAAPIAGIAMGLVKEESGFAVL
SDILGDEDHLGDMDFKVAGTEQGVTALQMDIKITGITQEIMHIALKQAKEGRLHILKEME
KAIGSSNQDVATTAPRFFTVKVKPEKVREIIGKGGATIRSITEETGVTIEIDDDGNVKIA
AVDDESANAAKARIAEITAEPEIGKVYDAKVVKIVDFGAFVSYMPGREGLVHVSQIADER
VEDVNEYLKEGQEIKVRLTDVDKQGRVKLSIKAV
Download sequence
Identical sequences Q31GJ9
317025.Tcr_1129 WP_011370551.1.20162 gi|78485473|ref|YP_391398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]