SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 317025.Tcr_1392 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  317025.Tcr_1392
Domain Number - Region: 34-82
Classification Level Classification E-value
Superfamily POZ domain 0.0341
Family Tetramerization domain of potassium channels 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 317025.Tcr_1392
Sequence length 97
Comment (Thiomicrospira crunogena XCL-2)
Sequence
MHCKYIIEGYTEDGRKFRPSDWIDRIASLMASYGSSHRLVFSDLLHPELHDGQKCLIIDT
ELEIKDPTMFEYVMNFAKSNNLKISQVCDTMETKLGS
Download sequence
Identical sequences Q31FT6
WP_011370815.1.20162 317025.Tcr_1392 gi|78485736|ref|YP_391661.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]