SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 318161.Sden_0405 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  318161.Sden_0405
Domain Number - Region: 5-79
Classification Level Classification E-value
Superfamily BAG domain 0.00837
Family BAG domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 318161.Sden_0405
Sequence length 84
Comment (Shewanella denitrificans OS217)
Sequence
MFNPKKIEDVAKQLSENLPSGLKQFAGEFEERSKQILQNQLMKLDFVSREEFEVQQHVLL
KTREKLEALQAQVNELEKKLAEQA
Download sequence
Identical sequences Q12S78
WP_011494864.1.19895 318161.Sden_0405 gi|91791770|ref|YP_561421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]