SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 318161.Sden_1442 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318161.Sden_1442
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Flavoproteins 1.12e-21
Family Hypothetical protein YwqN 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 318161.Sden_1442
Sequence length 132
Comment (Shewanella denitrificans OS217)
Sequence
MSIAIVLGTSRSDGNTSALANEFAQATGANVFPLSDFSILPFDYEFKNTSDDFLLLINQV
IKHDIIIFASPIYWYSPSAQMKVFMDRLSDLLKLISHLEGSCVGKLPGCYLRAVTLCLKI
VSNRYFAVPLNI
Download sequence
Identical sequences Q12P98
gi|91792800|ref|YP_562451.1| WP_011495886.1.19895 318161.Sden_1442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]