SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 318161.Sden_2908 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318161.Sden_2908
Domain Number 1 Region: 4-253
Classification Level Classification E-value
Superfamily CorA soluble domain-like 4.71e-54
Family CorA soluble domain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 256-318
Classification Level Classification E-value
Superfamily Magnesium transport protein CorA, transmembrane region 0.0000000000000732
Family Magnesium transport protein CorA, transmembrane region 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 318161.Sden_2908
Sequence length 321
Comment (Shewanella denitrificans OS217)
Sequence
MTSGFIYSLLLTGPNAGQSLTLAQVEQWQPSDGLLWMHLRYREPQAQAWVHKAGLSKVEV
DTLLAQDTRPRVLNTARGMLLALRGVNLNPGSDPEDMVSVRLYAEEHRIISTCERQLQSI
HSLAEQIKHGKGPVDSAAFIMQLCELLTHRKVEFISKLEDEIDELEEQVVTRANKNLRND
IAELRRQTVVTRRYLAPQREAFFRMLNDHNDLFDEADEVRIREINEILIRVIEDLDTIRD
RAGVTHEELQSQQAEQLNQRLYFLSLISAVFLPLGFLTGLLGVNIGGIPGAETDWAFSAF
CIGLAVIIAMQMLIFYRLKWL
Download sequence
Identical sequences Q12K40
WP_011497335.1.19895 318161.Sden_2908 gi|91794258|ref|YP_563909.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]