SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 319224.Sputcn32_2829 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319224.Sputcn32_2829
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.2e-50
Family Ribonuclease PH domain 1-like 0.0000205
Further Details:      
 
Domain Number 2 Region: 292-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.43e-46
Family Ribonuclease PH domain 1-like 0.0000128
Further Details:      
 
Domain Number 3 Region: 144-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.4e-28
Family Ribonuclease PH domain 2-like 0.00086
Further Details:      
 
Domain Number 4 Region: 449-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.25e-27
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 5 Region: 553-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.58e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 
Domain Number 6 Region: 619-696
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.11e-21
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 
Domain Number 7 Region: 238-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 7.06e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 319224.Sputcn32_2829
Sequence length 699
Comment (Shewanella putrefaciens CN-32)
Sequence
MNPIVKSFEYGQHTVTLETGVIARQADAAVLASMGDTTVLVTVVGKKEAEAGRDFFPLTV
NYQEKTYAAGKIPGGFFKREGRPSEDETLIARLIDRPIRPLFPNGFKNEVQVIITVVSVD
PQIEPDIISMIGTSAALAISGIPFSGPLGAARVGYINGEYVLNPTVAQIETSQLNLVVAG
TASAVLMVESEAQALPEEVMLGSVVYGHDQQQVVINAIAEFKAEAGKPMWDWTAPVQDET
LVAQIKELAEAGLGDAYKIQVKQDRYAQVAVVKAATKEALLASNPNIDLREVDNLLGSLE
KKVVRGRIIRGEPRIDGREPDMIRALSVLAGVLPRTHGSALFTRGETQALVTCTLGTERD
AQKIDSIMGERTNRFMLHYNFPPYSVGETGMVGSPKRREIGHGKLAWRGINAVMPSAEEF
PYSVRVVSEITESNGSSSMASVCGTSLALMDAGVPIKTSVAGIAMGLVKEGDDFVVLSDI
LGDEDHLGDMDFKVAGTRGGITALQMDIKIEGITKEIMEIALQQAYGARVHILNVMDQAI
GSHRDDISDHAPRITTIKINPEKIRDVIGKGGAVIRALTEETGTTIELEDDGTVRIASSN
GEATKEAIRRIEEITSEVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVAN
VSDHLELNQEVAVKVMEVDRQGRVRLSIKEAQTKEAAAE
Download sequence
Identical sequences A1RGY0 A4Y9B5 E6XJ81
gi|120597905|ref|YP_962479.1| gi|146293923|ref|YP_001184347.1| 319224.Sputcn32_2829 351745.Sputw3181_1075 WP_011788448.1.65999 WP_011788448.1.82224 WP_011788448.1.85280 WP_011788448.1.98421 gi|386314675|ref|YP_006010840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]