SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 319224.Sputcn32_2953 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319224.Sputcn32_2953
Domain Number 1 Region: 7-119
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.57e-27
Family SMI1/KNR4-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 319224.Sputcn32_2953
Sequence length 121
Comment (Shewanella putrefaciens CN-32)
Sequence
MKIFEFVPPTDKEIEEAQLKLGFKFSPEYIEFIKSGYDLGDAPIEALEISNPPSHADIFE
TLANARKYFQLPSELCPICEDNSDYYCLNQKGEVVFWSHNGTTSEKWANVTVWRNQMATE
V
Download sequence
Identical sequences A4Y9N5
NYSGXRC-10412k 2005183709 WP_011919827.1.82224 319224.Sputcn32_2953 gi|146294043|ref|YP_001184467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]