SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 319225.Plut_0132 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319225.Plut_0132
Domain Number 1 Region: 1-117,187-299
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.97e-75
Family FabD-like 0.0000151
Further Details:      
 
Domain Number 2 Region: 124-192
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000000000379
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 319225.Plut_0132
Sequence length 301
Comment (Chlorobium luteolum DSM 273)
Sequence
MKAFVFPGQGSQYCGMGRDIYDTFPAAKALMEQANDILGYRITDIMFLGSEEELRQTMHT
QPAIFLHSMAAASQLNAEGVAMTAGHSLGEYSALCFAGAISFEDAVKIVAERGRLMQQAG
TEKPGTMAAIIGMQDSALDALLAEAGAEGIVQAANFNSPGQIVISGDIAAVKKAVELAPA
HGARMAKELVVSGAFHSPLMKPAEEKLAAALEAVDIKNATIPVCMNAVARTVTDAAEIRK
NLVLQLTSSVLWTQSIEEMTTAGITRFVEVGPQKVLQGLIKRISKGAELEGKDTAADIQG
A
Download sequence
Identical sequences Q3B6K9
319225.Plut_0132 WP_011356898.1.73161 gi|78186022|ref|YP_374065.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]