SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 319225.Plut_1635 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319225.Plut_1635
Domain Number 1 Region: 309-505
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.27e-50
Family Ribonuclease PH domain 1-like 0.0000119
Further Details:      
 
Domain Number 2 Region: 11-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-46
Family Ribonuclease PH domain 1-like 0.0000376
Further Details:      
 
Domain Number 3 Region: 467-565
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.7e-27
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 4 Region: 138-230
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.89e-25
Family Ribonuclease PH domain 2-like 0.0024
Further Details:      
 
Domain Number 5 Region: 573-656
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.85e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 6 Region: 625-717
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.42e-17
Family Cold shock DNA-binding domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 319225.Plut_1635
Sequence length 732
Comment (Chlorobium luteolum DSM 273)
Sequence
MIITKEINLGQGKTISIETGRMAKQADGATVVRMGDTMVIATVVSSRKTPSVNQDFFPLQ
VEYREKYYAAGKFPGGFFKREARPSEKEILSARLIDRALRPLFPTGYYHETQVIINVISS
DQQNDADVLGGLAASAAIMVSDIPFENAMSEVRVGRVNGLFIINPTIDELEGSDIDISIG
GTADTICMLEGEMKEISEAEMLDAIKFGHEAIKKLCQLQNELAGEVAKAKRPFTPLQVPA
ELSEYVKNACESSLKELAYKPLAKEVRADETKAIYSETVKKAIEHFSAAFGPEALAADPS
KALCLNEHIIEEEIHSFEKNVMRRMILDDGKRLDGRNLEQVRPITIELGVIPRAHGSALF
TRGETQALVAVTLGTKKDAQSVDTLTNSADKRFMLHYNFPPFSVGEVGRLGSTGRREIGH
GNLAERSIKMVAPGEQEFPYTVRIVSEILESNGSSSMASVCGGTLALMDGGVPLKKPVSG
IAMGLIKDGEEYAVLSDILGNEDHLGDMDFKVAGTRDGITACQMDIKIDGLDYHILENAL
AQARRGRFHILDKMEEAIPASREELAQYAPRLTAIQVPVESIGLIIGKGGETIRSITEET
GAEINIEDDGTVTIACSSNEGTKAAVEIIKALIAKPEVGTIYVGKVRDVRDELGAFVEFI
PKTDGLVHISEISRERVTKVSDHLKVGDRIKVKLVDIRKDPRTGKTRFALSMKAVDEEPV
NGTEAGAAPENN
Download sequence
Identical sequences Q3B2E2
319225.Plut_1635 gi|78187489|ref|YP_375532.1| WP_011358361.1.73161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]