SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31964.CMS_1186 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31964.CMS_1186
Domain Number 1 Region: 332-503
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-42
Family Ribonuclease PH domain 1-like 0.000000674
Further Details:      
 
Domain Number 2 Region: 9-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.57e-41
Family Ribonuclease PH domain 1-like 0.00000074
Further Details:      
 
Domain Number 3 Region: 153-265
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.92e-25
Family Ribonuclease PH domain 2-like 0.0000168
Further Details:      
 
Domain Number 4 Region: 485-584
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.3e-22
Family Ribonuclease PH domain 2-like 0.0000247
Further Details:      
 
Domain Number 5 Region: 589-699
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.66e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 273-356
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000000131
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31964.CMS_1186
Sequence length 757
Comment (Clavibacter michiganensis sepedonicus)
Sequence
MEGPEIKFAEAVLDNGKYGTRTVRFEAGRLAQQAQGAVAAYLDEDTMLLSATSVGKHPKD
NFDFFPLTIDVEERSYAAGKIPGSFFRREGRPSTEAILVCRLIDRPLRPSFITGLRNEVQ
VVITVLSIAPDEFYDSLAINAASASSMLSGIPFSGPIAGVRLALIGDQWVVFPKHSQLKE
AVFDITVAGRVVTDAQGNEDVAIMMVEAEATEGAWDLIQAGATKPDEAVVAQGLEAAKPF
IRQLVAAQASLAQQAAKPTVDYPVFLPYAQQSYDAVSALALEELGTVYRIADKIERQDAD
DALKTRTKEAVAAKVEAGELPQSALTEFSAAYKSVTKTVVRGRILRDGIRMDGRGLADIR
PLDAEVQVIPRVHGSAIFQRGETQILGVTTLNMLKMEQQIDSLSPVTKKRFMTHYNFPPY
STGETGRVGSPKRREIGHGFLAERALVPVLPSREDFPYAIRQVSEALGSNGSTSMGSVCA
STLSLLNAGVPLRAPVAGIAMGLVSDTVDGQVRYAALTDILGAEDALGDMDFKVAGTSEF
VTAIQLDTKLDGIPTSVLDGALKQAKEARTAILGVLNQAIDAPDEMAPTAPRVISVNIPV
DKIGELIGPKGKTINAIQDETGADISIEEDGAVYIGAVDGPSAEAARAQVNAIANPTNPE
VGESFLGTVVKIATFGAFVSLLPGKDGLLHISEVRKLAGGKRVENVEDVLGVGQKILVEI
TKIDDRGKLSLAPVMEEAADQEGSAAASDGPEAPAEG
Download sequence
Identical sequences B0RGW7
31964.CMS_1186 gi|170781592|ref|YP_001709924.1| WP_012298580.1.12855 WP_012298580.1.13751 WP_012298580.1.33835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]