SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31964.CMS_1712 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31964.CMS_1712
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.01e-29
Family Single-domain sulfurtransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31964.CMS_1712
Sequence length 99
Comment (Clavibacter michiganensis sepedonicus)
Sequence
MKSITVHDLAAATGATIIDVREPDEYAGGHARSAVNVPLSELGERLDEIPTDQPVHVICQ
SGGRSARATDALAARGIDAIDVTGGTSAWIDADLPTDRA
Download sequence
Identical sequences B0RCP6
31964.CMS_1712 gi|170782092|ref|YP_001710425.1| WP_012299065.1.12855 WP_012299065.1.13751 WP_012299065.1.33835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]