SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 319701.M28_Spy1648 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319701.M28_Spy1648
Domain Number 1 Region: 7-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.09e-44
Family Ribonuclease PH domain 1-like 0.0000396
Further Details:      
 
Domain Number 2 Region: 297-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-41
Family Ribonuclease PH domain 1-like 0.00001
Further Details:      
 
Domain Number 3 Region: 143-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.14e-29
Family Ribonuclease PH domain 2-like 0.002
Further Details:      
 
Domain Number 4 Region: 453-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-28
Family Ribonuclease PH domain 2-like 0.0000942
Further Details:      
 
Domain Number 5 Region: 623-706
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.29e-21
Family Cold shock DNA-binding domain-like 0.00099
Further Details:      
 
Domain Number 6 Region: 559-643
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.71e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 7 Region: 236-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000000628
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 319701.M28_Spy1648
Sequence length 710
Comment (Streptococcus pyogenes MGAS6180)
Sequence
MSKQTFTTTFAGKPLVVEVGQVAKQANGATVVRYGESTVLTAAVMSKKMATGDFFPLQVN
YEEKMYAAGKFPGGFMKREGRPSTDATLTARLIDRPIRPMFAEGFRNEVQVINTVLSYDE
NASAPMAAMFGSSLALSISDIPFNGPIAGVQVGYIDGEFIINPDKEQMEASLLELTVAGS
KEAINMVESGAKELSEDIMLEALLKGHQAIQELIAFQEQIVAVVGKEKAEVELLQVDADL
QADIVAKYNAQLQKAVQVEEKKAREAATEAVKEMVKAEYEERYAEDENLATIMRDVAEIL
EQMEHAEVRRLITEDKIRPDGRKIDEIRPLDAVVDFLPKVHGSGLFTRGQTQALSILTLA
PMGETQIIDGLAPEYKKRFLHHYNFPQYSVGETGRYGAAGRREIGHGALGERALEQVLPS
LEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGVPIKAPVAGIAMGLISDGTNYTV
LTDIQGLEDHFGDMDFKVAGTREGITALQMDIKIAGITPQILEEALAQAKKARFEILDVI
EATIAEPRPELAPTAPKIDTIKIDVDKIKVVIGKGGETIDKIIAETGVKIDIDDEGNVSI
YSSDQAAINRTKEIIAGLVREAKVGEVYHAKVVRIEKFGAFVNLFDKTDALVHISEIAWT
RTTNVSDVLEVGEDVDVKVIKIDEKGRVDASMKALIPRPPKPEKKEEKHD
Download sequence
Identical sequences Q1JEW6 Q48RA2
gi|94991237|ref|YP_599337.1| 319701.M28_Spy1648 370552.MGAS10270_Spy1728 gi|525810236|ref|YP_008243907.1| WP_011285185.1.1526 WP_011285185.1.21068 WP_011285185.1.27096 WP_011285185.1.39740 WP_011285185.1.40473 WP_011285185.1.58073 WP_011285185.1.58327 WP_011285185.1.60269 WP_011285185.1.61350 WP_011285185.1.68302 WP_011285185.1.7902 WP_011285185.1.81017 WP_011285185.1.94718 WP_011285185.1.97489 gi|71904310|ref|YP_281113.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]