SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 319795.Dgeo_0159 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319795.Dgeo_0159
Domain Number 1 Region: 6-160
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.45e-40
Family Multidomain sulfurtransferase (rhodanese) 0.00063
Further Details:      
 
Domain Number 2 Region: 158-287
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.49e-24
Family Multidomain sulfurtransferase (rhodanese) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 319795.Dgeo_0159
Sequence length 292
Comment (Deinococcus geothermalis DSM 11300)
Sequence
MTATESPLKSAEWLLAHLNDPQVRVLDCRYALTDPLLGRIAYLEGHIPGAIYADLETDLS
GPVRPDGAGGRHPLPDPATLAAWLGRVGIGNDSVVVAYDDPRGGQGFYATRAWWLLRWLG
HQQVYVLDGGWPAFLAAGGQPSTAEPEFAPTTFRPDVQMDMVATAEDVAGRDAHTLLIDA
RAPNRYRGEVEPLDRKAGHIPGAVNREWAGALDESGHWREAQAQAARLKAGDAPTITYCG
SGVSATPNLLARELAGVPLGPQNRLYAGSWSDWISDDARPVATGEEPGSRKP
Download sequence
Identical sequences Q1J222
319795.Dgeo_0159 WP_011529309.1.71355 gi|94984267|ref|YP_603631.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]