SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 319795.Dgeo_0162 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319795.Dgeo_0162
Domain Number 1 Region: 366-492
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.04e-28
Family HD domain 0.017
Further Details:      
 
Domain Number 2 Region: 249-345
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000209
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 319795.Dgeo_0162
Sequence length 562
Comment (Deinococcus geothermalis DSM 11300)
Sequence
MNMLYFVLALLVGLAGGFFVGQARGRQQRATLDDQLQREARAEAERIRTQADAEARQLRE
QAEQRLQDAARRLQEADDRERQVTLQLEAQREQLQAVRAQIEAERARAAQDAARERETLS
ADRQETRREREELKREIERLNRRAEQLDARGDKLDALEERLEGQLHALAQQEAELAERSR
QVDLKLYEVAGLTPEAAREQILRQLDAELEEEKAIRVKAMTERATAEARRTARNVIAQAI
QRSASETSSQMSVSVVPIPNDAMKGRLIGREGRNIRAFEALTGVDLIIDDTPEAVILSSF
NPVRREVARHVLEALVADGRIHPTRIEEMVHKAQDEMKSFIHAQGEEAAIESGVVGLKPG
LVQLLGRMYFRSSYGQNVLKHSVQVAHLTGIMADELGLDAALARRAGLMHDIGKSIDREI
EGTHVEIGINLAKRFGEPPEVIDAIAHHHDPENGETLYSVLVAAADAISAARPGARREEL
EAYVRRLEQLEQIAIAFPGVQQAYAIQAGREVRVLVQPEKVTDAQATLLAREIAGRIEQD
MEYPGQVQVTVVRESRAVEVAR
Download sequence
Identical sequences Q1J219
gi|94984270|ref|YP_603634.1| 319795.Dgeo_0162 WP_011529312.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]