SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 319795.Dgeo_2217 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319795.Dgeo_2217
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 1.67e-34
Family Ribosomal L27 protein 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 319795.Dgeo_2217
Sequence length 91
Comment (Deinococcus geothermalis DSM 11300)
Sequence
MAHKKGVGSSKNGRDSNPKYLGVKKFGGEAVVAGNILVRQRGTKFKPGANVGMGRDHTLF
ALVDGKVVFTNRGAKGRFISVEAAAPQVAAD
Download sequence
Identical sequences Q1IW73
319795.Dgeo_2217 gi|94986316|ref|YP_605680.1| WP_011531332.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]