SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 320372.BURPS1710b_1718 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  320372.BURPS1710b_1718
Domain Number - Region: 69-104
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00928
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.094
Further Details:      
 
Domain Number - Region: 3-32
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0633
Family PHD domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 320372.BURPS1710b_1718
Sequence length 133
Comment (Burkholderia pseudomallei 1710b)
Sequence
MSDCSKHPEWKPTGLQWKCPFCTPISNRPLTTKQKARVAAAGDAVRIDDLSGGAWDVIRK
RIRKRAGYCCRACGVAVRAGVVDHIKPLAQGGSNADENLQLLCKECHDDKTNADQGYKVR
RRVGVDGLPEGWA
Download sequence
Identical sequences A0A0E1WAS4 Q3JTI4
gi|76808941|ref|YP_333119.1| WP_004526701.1.18405 WP_004526701.1.18744 WP_004526701.1.18906 WP_004526701.1.38442 WP_004526701.1.43156 WP_004526701.1.5413 WP_004526701.1.58405 WP_004526701.1.65994 WP_004526701.1.83487 WP_004526701.1.84379 WP_004526701.1.9983 320372.BURPS1710b_1718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]