SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 320372.BURPS1710b_A0725 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  320372.BURPS1710b_A0725
Domain Number 1 Region: 2-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.22e-37
Family G proteins 0.0002
Further Details:      
 
Domain Number 2 Region: 269-365
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 4.32e-20
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0045
Further Details:      
 
Domain Number 3 Region: 174-261
Classification Level Classification E-value
Superfamily Translation proteins 1.79e-19
Family Elongation factors 0.0019
Further Details:      
 
Domain Number 4 Region: 436-506
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000223
Family C-terminal fragment of elongation factor SelB 0.042
Further Details:      
 
Domain Number 5 Region: 509-571
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000226
Family C-terminal fragment of elongation factor SelB 0.046
Further Details:      
 
Domain Number 6 Region: 576-632
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000417
Family C-terminal fragment of elongation factor SelB 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 320372.BURPS1710b_A0725
Sequence length 641
Comment (Burkholderia pseudomallei 1710b)
Sequence
MIVGTAGHIDHGKTTLVRALTGVDTDRLKEEKARGISIELGYAYTPLPNGDVLGFIDVPG
HEKLVHTMAAGACGIDFALVVIAADDGVMPQTREHLSILQLLGVAHGALALTKCDRVDAA
RVARVRDEIRAWLAASPLADAPVFETRASEPDDAGVAALNAHLRDTALAWRARRDDGLFR
LAVDRVFTLAGQGTVVTGTAVAGRVRTGDSLAVARTGETVRVRSIHAQNRATDVGHAGER
CALNLAGIDKAALARGDAIVDARLATLSPRIDVELTLTADADLTISHWTPLHVHLGTLHR
VAHVALLEGETLGPGRRARAQLNFTEPVFAAPGDRFIVRDAQATRTVGGGRVLDPFGPAR
KRRTRARRAWLDALAAWLDEGRLDALLDEAPLGIARATLMHLTGLPAQAWALPADAVSVA
APGKHADEARVLARGHWDALRTRVLDALAAFHQRSPDEQGPDVARLRRIAAPLADDALWR
ALTDALIAEGAIVRSGPWLHVPSHAVSFDAAEEALAGRLLPLVAAGRYDPPWVRDHAAAT
LMAEDAVRALLRKLARRGDVHQVVRDLFYHRDVIAELARLIARLAGEHGGGLDAATFRDA
TGLGRKRAIQILEFFDRVGYTRFHRDLHWLRADSRLLAGSR
Download sequence
Identical sequences A0A0E1VU75 Q3JKL9
gi|76818051|ref|YP_335884.1| WP_004528942.1.12731 WP_004528942.1.18396 WP_004528942.1.18405 WP_004528942.1.18744 WP_004528942.1.18906 WP_004528942.1.36944 WP_004528942.1.38442 WP_004528942.1.43156 WP_004528942.1.58405 WP_004528942.1.59519 WP_004528942.1.65994 WP_004528942.1.68922 WP_004528942.1.83487 320372.BURPS1710b_A0725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]