SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 320373.BURPS668_1285 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  320373.BURPS668_1285
Domain Number 1 Region: 4-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-51
Family Ribonuclease PH domain 1-like 0.0000139
Further Details:      
 
Domain Number 2 Region: 301-495
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.18e-50
Family Ribonuclease PH domain 1-like 0.0000175
Further Details:      
 
Domain Number 3 Region: 147-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.79e-30
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 4 Region: 457-555
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.38e-28
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 561-647
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.37e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 6 Region: 627-704
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.54e-20
Family Cold shock DNA-binding domain-like 0.00037
Further Details:      
 
Domain Number 7 Region: 241-328
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.1e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 320373.BURPS668_1285
Sequence length 713
Comment (Burkholderia pseudomallei 668)
Sequence
MSLFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDIEDTVVLATVVGAKSAKPGQDFFP
LTVDYIEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQVVIHVL
SVNPEIPADIPALIGASAALAVSGLPFNGPVGAARVAYVNNEYVLNPTREQIKASRLDLV
VAGTERAVLMVESEADQLPEDVMLGAVVFGHEQMQTAIDAIHELVREGGKPEWDWQPAPK
DEALNARVTELAQPELLAAYQIRDKQARSTKLKEVYAATSAKLEEEAVAAGTVAADKATV
GNILFDLEAKIVRGQILNGEPRIDGRDTRTVRPIEIRTGVLPRTHGSALFTRGETQALVV
ATLGTKGDEQIIDALEGEYRERFMLHYNMPPFATGETGRVGSPKRREIGHGRLAKRALVA
CLPSADEFGYSIRVVSEITESNGSSSMASVCGGCLALMDAGVPMKAHVAGIAMGLILEGN
KFAVLTDILGDEDHLGDMDFKVAGTADGVTALQMDIKIQGITKEIMQVALAQAKEGRMHI
LGKMKDAVAGANTQLSEFAPRMITIKINPEKIRDVIGKGGSVIRALTEETGTTIDISDDG
VVTIASTNSEGMAEAKKRIENITAEIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISE
IVNERVKDINDYLKEGQQVKVKVIQTDEKGRVRLSAKALLNEAAAQADTPPQQ
Download sequence
Identical sequences A0A069B6J3 A0A0E1S258 A0A0E1U2T3 A0A0E1UND0 A0A0E1VZ33 A0A0F6G9Q1 A0A0F6L729 A0A0H3HKU4 A0A2K3F7T5 A0A2K3G7W8 A0A2K3HDL6 A0A2K3I3V8 A3N7L3 A3NTA2 C4KU63 Q3JUB3 Q63VN7
gi|386862398|ref|YP_006275347.1| gi|76810240|ref|YP_332840.1| gi|403518000|ref|YP_006652133.1| gi|237811578|ref|YP_002896029.1| gi|556575030|ref|YP_008742927.1| WP_004526459.1.100195 WP_004526459.1.10047 WP_004526459.1.100583 WP_004526459.1.100720 WP_004526459.1.100825 WP_004526459.1.100900 WP_004526459.1.1010 WP_004526459.1.101060 WP_004526459.1.101381 WP_004526459.1.101559 WP_004526459.1.101588 WP_004526459.1.101783 WP_004526459.1.102051 WP_004526459.1.10269 WP_004526459.1.10359 WP_004526459.1.10553 WP_004526459.1.10633 WP_004526459.1.10907 WP_004526459.1.1098 WP_004526459.1.11046 WP_004526459.1.11072 WP_004526459.1.11160 WP_004526459.1.11268 WP_004526459.1.11404 WP_004526459.1.11825 WP_004526459.1.11893 WP_004526459.1.11996 WP_004526459.1.11998 WP_004526459.1.12731 WP_004526459.1.12793 WP_004526459.1.12856 WP_004526459.1.12860 WP_004526459.1.13198 WP_004526459.1.13309 WP_004526459.1.13504 WP_004526459.1.13520 WP_004526459.1.13597 WP_004526459.1.13603 WP_004526459.1.13639 WP_004526459.1.13950 WP_004526459.1.14539 WP_004526459.1.1465 WP_004526459.1.14660 WP_004526459.1.15364 WP_004526459.1.15525 WP_004526459.1.15673 WP_004526459.1.16090 WP_004526459.1.16113 WP_004526459.1.16249 WP_004526459.1.16358 WP_004526459.1.16540 WP_004526459.1.16561 WP_004526459.1.16625 WP_004526459.1.16680 WP_004526459.1.16689 WP_004526459.1.16749 WP_004526459.1.17067 WP_004526459.1.17068 WP_004526459.1.17278 WP_004526459.1.17473 WP_004526459.1.17786 WP_004526459.1.18058 WP_004526459.1.18396 WP_004526459.1.18405 WP_004526459.1.18549 WP_004526459.1.18631 WP_004526459.1.18704 WP_004526459.1.18744 WP_004526459.1.18868 WP_004526459.1.18906 WP_004526459.1.19486 WP_004526459.1.19540 WP_004526459.1.19629 WP_004526459.1.1976 WP_004526459.1.19815 WP_004526459.1.19854 WP_004526459.1.20021 WP_004526459.1.20246 WP_004526459.1.20501 WP_004526459.1.20520 WP_004526459.1.20673 WP_004526459.1.20954 WP_004526459.1.21147 WP_004526459.1.21205 WP_004526459.1.21291 WP_004526459.1.21409 WP_004526459.1.21461 WP_004526459.1.21809 WP_004526459.1.21907 WP_004526459.1.22046 WP_004526459.1.22299 WP_004526459.1.22308 WP_004526459.1.2261 WP_004526459.1.22779 WP_004526459.1.23009 WP_004526459.1.23086 WP_004526459.1.23104 WP_004526459.1.23131 WP_004526459.1.2317 WP_004526459.1.23743 WP_004526459.1.23852 WP_004526459.1.23994 WP_004526459.1.24020 WP_004526459.1.2404 WP_004526459.1.24134 WP_004526459.1.24314 WP_004526459.1.24372 WP_004526459.1.24454 WP_004526459.1.24513 WP_004526459.1.2462 WP_004526459.1.24701 WP_004526459.1.25068 WP_004526459.1.25102 WP_004526459.1.25265 WP_004526459.1.25412 WP_004526459.1.25628 WP_004526459.1.259 WP_004526459.1.26054 WP_004526459.1.26502 WP_004526459.1.26535 WP_004526459.1.26565 WP_004526459.1.26633 WP_004526459.1.26645 WP_004526459.1.267 WP_004526459.1.26849 WP_004526459.1.27064 WP_004526459.1.27069 WP_004526459.1.27146 WP_004526459.1.27363 WP_004526459.1.27390 WP_004526459.1.27399 WP_004526459.1.27420 WP_004526459.1.27597 WP_004526459.1.27810 WP_004526459.1.28018 WP_004526459.1.28066 WP_004526459.1.28594 WP_004526459.1.28619 WP_004526459.1.29161 WP_004526459.1.29178 WP_004526459.1.29335 WP_004526459.1.29405 WP_004526459.1.29508 WP_004526459.1.29520 WP_004526459.1.29547 WP_004526459.1.29658 WP_004526459.1.29853 WP_004526459.1.29878 WP_004526459.1.29887 WP_004526459.1.29899 WP_004526459.1.29948 WP_004526459.1.30311 WP_004526459.1.30382 WP_004526459.1.3041 WP_004526459.1.30671 WP_004526459.1.3069 WP_004526459.1.30729 WP_004526459.1.30937 WP_004526459.1.30966 WP_004526459.1.31343 WP_004526459.1.31723 WP_004526459.1.32174 WP_004526459.1.32182 WP_004526459.1.32221 WP_004526459.1.324 WP_004526459.1.32581 WP_004526459.1.3273 WP_004526459.1.33077 WP_004526459.1.33130 WP_004526459.1.33157 WP_004526459.1.33158 WP_004526459.1.33165 WP_004526459.1.332 WP_004526459.1.33366 WP_004526459.1.33493 WP_004526459.1.33573 WP_004526459.1.33779 WP_004526459.1.34230 WP_004526459.1.34333 WP_004526459.1.34393 WP_004526459.1.34564 WP_004526459.1.35025 WP_004526459.1.35052 WP_004526459.1.35090 WP_004526459.1.35141 WP_004526459.1.35227 WP_004526459.1.35249 WP_004526459.1.35474 WP_004526459.1.35485 WP_004526459.1.35491 WP_004526459.1.35825 WP_004526459.1.36106 WP_004526459.1.36174 WP_004526459.1.36259 WP_004526459.1.36527 WP_004526459.1.366 WP_004526459.1.36662 WP_004526459.1.36666 WP_004526459.1.36944 WP_004526459.1.37 WP_004526459.1.3706 WP_004526459.1.37373 WP_004526459.1.37428 WP_004526459.1.37446 WP_004526459.1.37517 WP_004526459.1.37535 WP_004526459.1.37581 WP_004526459.1.37622 WP_004526459.1.37627 WP_004526459.1.37690 WP_004526459.1.37725 WP_004526459.1.37934 WP_004526459.1.37959 WP_004526459.1.37994 WP_004526459.1.38115 WP_004526459.1.38442 WP_004526459.1.38490 WP_004526459.1.38683 WP_004526459.1.3872 WP_004526459.1.38810 WP_004526459.1.39078 WP_004526459.1.39162 WP_004526459.1.39179 WP_004526459.1.3947 WP_004526459.1.39595 WP_004526459.1.39757 WP_004526459.1.39898 WP_004526459.1.40021 WP_004526459.1.40235 WP_004526459.1.40275 WP_004526459.1.40388 WP_004526459.1.40390 WP_004526459.1.40426 WP_004526459.1.40448 WP_004526459.1.41588 WP_004526459.1.41945 WP_004526459.1.42408 WP_004526459.1.42492 WP_004526459.1.42496 WP_004526459.1.42800 WP_004526459.1.43136 WP_004526459.1.43156 WP_004526459.1.43373 WP_004526459.1.43542 WP_004526459.1.43587 WP_004526459.1.43678 WP_004526459.1.43727 WP_004526459.1.43786 WP_004526459.1.44352 WP_004526459.1.44414 WP_004526459.1.44824 WP_004526459.1.45284 WP_004526459.1.45348 WP_004526459.1.45356 WP_004526459.1.45537 WP_004526459.1.45715 WP_004526459.1.4631 WP_004526459.1.46757 WP_004526459.1.46829 WP_004526459.1.4693 WP_004526459.1.46969 WP_004526459.1.47086 WP_004526459.1.47149 WP_004526459.1.4718 WP_004526459.1.47564 WP_004526459.1.48093 WP_004526459.1.48464 WP_004526459.1.49026 WP_004526459.1.49717 WP_004526459.1.49872 WP_004526459.1.50174 WP_004526459.1.50320 WP_004526459.1.50336 WP_004526459.1.50401 WP_004526459.1.50636 WP_004526459.1.50788 WP_004526459.1.50839 WP_004526459.1.5105 WP_004526459.1.51606 WP_004526459.1.51666 WP_004526459.1.5173 WP_004526459.1.5182 WP_004526459.1.51874 WP_004526459.1.51891 WP_004526459.1.52229 WP_004526459.1.52365 WP_004526459.1.52407 WP_004526459.1.52451 WP_004526459.1.52521 WP_004526459.1.52547 WP_004526459.1.52643 WP_004526459.1.52655 WP_004526459.1.52731 WP_004526459.1.52882 WP_004526459.1.5292 WP_004526459.1.53034 WP_004526459.1.53048 WP_004526459.1.53103 WP_004526459.1.53132 WP_004526459.1.53282 WP_004526459.1.53386 WP_004526459.1.53506 WP_004526459.1.53578 WP_004526459.1.54016 WP_004526459.1.5413 WP_004526459.1.54312 WP_004526459.1.54369 WP_004526459.1.54804 WP_004526459.1.54859 WP_004526459.1.55038 WP_004526459.1.55691 WP_004526459.1.55755 WP_004526459.1.55974 WP_004526459.1.5608 WP_004526459.1.56126 WP_004526459.1.56248 WP_004526459.1.5641 WP_004526459.1.56451 WP_004526459.1.56591 WP_004526459.1.56744 WP_004526459.1.56949 WP_004526459.1.56993 WP_004526459.1.57046 WP_004526459.1.57096 WP_004526459.1.57247 WP_004526459.1.57341 WP_004526459.1.57359 WP_004526459.1.5776 WP_004526459.1.58003 WP_004526459.1.58105 WP_004526459.1.58355 WP_004526459.1.58362 WP_004526459.1.58390 WP_004526459.1.58405 WP_004526459.1.58509 WP_004526459.1.58523 WP_004526459.1.58578 WP_004526459.1.58639 WP_004526459.1.58758 WP_004526459.1.5883 WP_004526459.1.59103 WP_004526459.1.59200 WP_004526459.1.59255 WP_004526459.1.59422 WP_004526459.1.59496 WP_004526459.1.59519 WP_004526459.1.59536 WP_004526459.1.59549 WP_004526459.1.59747 WP_004526459.1.60398 WP_004526459.1.60769 WP_004526459.1.60810 WP_004526459.1.60836 WP_004526459.1.60969 WP_004526459.1.61084 WP_004526459.1.61202 WP_004526459.1.61455 WP_004526459.1.61685 WP_004526459.1.61723 WP_004526459.1.61854 WP_004526459.1.6186 WP_004526459.1.62183 WP_004526459.1.62774 WP_004526459.1.63261 WP_004526459.1.63379 WP_004526459.1.63439 WP_004526459.1.63505 WP_004526459.1.63719 WP_004526459.1.63942 WP_004526459.1.64068 WP_004526459.1.64096 WP_004526459.1.64166 WP_004526459.1.64364 WP_004526459.1.64383 WP_004526459.1.64542 WP_004526459.1.64683 WP_004526459.1.64892 WP_004526459.1.65093 WP_004526459.1.65270 WP_004526459.1.65468 WP_004526459.1.65832 WP_004526459.1.65994 WP_004526459.1.66257 WP_004526459.1.66321 WP_004526459.1.66380 WP_004526459.1.66465 WP_004526459.1.67117 WP_004526459.1.67182 WP_004526459.1.67229 WP_004526459.1.67559 WP_004526459.1.6765 WP_004526459.1.67860 WP_004526459.1.67909 WP_004526459.1.6835 WP_004526459.1.68353 WP_004526459.1.68664 WP_004526459.1.68886 WP_004526459.1.68922 WP_004526459.1.69022 WP_004526459.1.69081 WP_004526459.1.69094 WP_004526459.1.69106 WP_004526459.1.69169 WP_004526459.1.69217 WP_004526459.1.69337 WP_004526459.1.69354 WP_004526459.1.69770 WP_004526459.1.70016 WP_004526459.1.7006 WP_004526459.1.70066 WP_004526459.1.70096 WP_004526459.1.70278 WP_004526459.1.71392 WP_004526459.1.71444 WP_004526459.1.71564 WP_004526459.1.71901 WP_004526459.1.72015 WP_004526459.1.72083 WP_004526459.1.72817 WP_004526459.1.73317 WP_004526459.1.73418 WP_004526459.1.73521 WP_004526459.1.73576 WP_004526459.1.73974 WP_004526459.1.74177 WP_004526459.1.74425 WP_004526459.1.7450 WP_004526459.1.74569 WP_004526459.1.74690 WP_004526459.1.75001 WP_004526459.1.75027 WP_004526459.1.75075 WP_004526459.1.75276 WP_004526459.1.75519 WP_004526459.1.75677 WP_004526459.1.75711 WP_004526459.1.75776 WP_004526459.1.75883 WP_004526459.1.75913 WP_004526459.1.75937 WP_004526459.1.76142 WP_004526459.1.76290 WP_004526459.1.76522 WP_004526459.1.76575 WP_004526459.1.766 WP_004526459.1.7703 WP_004526459.1.77249 WP_004526459.1.77287 WP_004526459.1.77319 WP_004526459.1.77689 WP_004526459.1.77788 WP_004526459.1.77845 WP_004526459.1.78029 WP_004526459.1.78278 WP_004526459.1.78506 WP_004526459.1.78628 WP_004526459.1.78807 WP_004526459.1.78827 WP_004526459.1.79052 WP_004526459.1.79360 WP_004526459.1.795 WP_004526459.1.79689 WP_004526459.1.79710 WP_004526459.1.79725 WP_004526459.1.80302 WP_004526459.1.80395 WP_004526459.1.80433 WP_004526459.1.80923 WP_004526459.1.81042 WP_004526459.1.8126 WP_004526459.1.81479 WP_004526459.1.81543 WP_004526459.1.81665 WP_004526459.1.82197 WP_004526459.1.82323 WP_004526459.1.82394 WP_004526459.1.82506 WP_004526459.1.82694 WP_004526459.1.82727 WP_004526459.1.82915 WP_004526459.1.82950 WP_004526459.1.83080 WP_004526459.1.83357 WP_004526459.1.8341 WP_004526459.1.83487 WP_004526459.1.83543 WP_004526459.1.83567 WP_004526459.1.83609 WP_004526459.1.83688 WP_004526459.1.8388 WP_004526459.1.8390 WP_004526459.1.83967 WP_004526459.1.84002 WP_004526459.1.84026 WP_004526459.1.84181 WP_004526459.1.84375 WP_004526459.1.84379 WP_004526459.1.84866 WP_004526459.1.85170 WP_004526459.1.85412 WP_004526459.1.85443 WP_004526459.1.85467 WP_004526459.1.85490 WP_004526459.1.85565 WP_004526459.1.85584 WP_004526459.1.856 WP_004526459.1.85641 WP_004526459.1.85645 WP_004526459.1.85774 WP_004526459.1.8585 WP_004526459.1.8629 WP_004526459.1.86438 WP_004526459.1.86525 WP_004526459.1.86806 WP_004526459.1.8697 WP_004526459.1.87114 WP_004526459.1.87278 WP_004526459.1.87324 WP_004526459.1.87553 WP_004526459.1.87652 WP_004526459.1.87759 WP_004526459.1.87811 WP_004526459.1.88003 WP_004526459.1.88117 WP_004526459.1.88168 WP_004526459.1.88237 WP_004526459.1.88322 WP_004526459.1.88369 WP_004526459.1.88666 WP_004526459.1.88682 WP_004526459.1.88764 WP_004526459.1.88920 WP_004526459.1.89093 WP_004526459.1.8912 WP_004526459.1.89240 WP_004526459.1.89435 WP_004526459.1.89514 WP_004526459.1.89782 WP_004526459.1.90079 WP_004526459.1.90471 WP_004526459.1.9079 WP_004526459.1.90934 WP_004526459.1.91025 WP_004526459.1.91142 WP_004526459.1.91198 WP_004526459.1.91709 WP_004526459.1.91763 WP_004526459.1.91823 WP_004526459.1.92095 WP_004526459.1.92367 WP_004526459.1.92406 WP_004526459.1.92430 WP_004526459.1.92493 WP_004526459.1.92507 WP_004526459.1.9280 WP_004526459.1.92904 WP_004526459.1.93845 WP_004526459.1.94023 WP_004526459.1.94117 WP_004526459.1.94121 WP_004526459.1.94286 WP_004526459.1.94403 WP_004526459.1.94498 WP_004526459.1.94520 WP_004526459.1.9479 WP_004526459.1.94901 WP_004526459.1.94926 WP_004526459.1.95054 WP_004526459.1.95300 WP_004526459.1.95339 WP_004526459.1.95420 WP_004526459.1.95587 WP_004526459.1.95644 WP_004526459.1.95672 WP_004526459.1.95938 WP_004526459.1.96381 WP_004526459.1.97058 WP_004526459.1.97112 WP_004526459.1.97148 WP_004526459.1.97989 WP_004526459.1.98316 WP_004526459.1.98491 WP_004526459.1.98547 WP_004526459.1.98688 WP_004526459.1.98713 WP_004526459.1.98753 WP_004526459.1.98768 WP_004526459.1.98944 WP_004526459.1.99061 WP_004526459.1.99069 WP_004526459.1.99160 WP_004526459.1.99233 WP_004526459.1.99290 WP_004526459.1.9962 WP_004526459.1.99741 WP_004526459.1.9975 WP_004526459.1.9983 WP_004526459.1.99890 YP_107829.1.59693 gi|526471608|ref|YP_008340984.1| gi|126439036|ref|YP_001058334.1| gi|53718843|ref|YP_107829.1| gi|126454918|ref|YP_001065573.1| 272560.BPSL1207 320372.BURPS1710b_1430 320373.BURPS668_1285 357348.BURPS1106A_1294 536230.GBP346_A1309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]