SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 320389.BMA10247_0408 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  320389.BMA10247_0408
Domain Number 1 Region: 4-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-51
Family Ribonuclease PH domain 1-like 0.0000137
Further Details:      
 
Domain Number 2 Region: 301-495
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.18e-50
Family Ribonuclease PH domain 1-like 0.0000175
Further Details:      
 
Domain Number 3 Region: 147-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.79e-30
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 4 Region: 457-555
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.38e-28
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 561-647
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.37e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 6 Region: 627-704
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.54e-20
Family Cold shock DNA-binding domain-like 0.00037
Further Details:      
 
Domain Number 7 Region: 241-328
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.88e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 320389.BMA10247_0408
Sequence length 713
Comment (Burkholderia mallei NCTC 10247)
Sequence
MSLFNKIVKEFQWGQQKVRLETGEIARQASGAVIVDIEDTVVLATVVGAKSAKPGQDFFP
LTVDYIEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQVVIHVL
SVNPEIPADIPALIGASAALAVSGLPFNGPVGAARVAYVNNEYVLNPTREQIKASRLDLV
VAGTERAVLMVESEADQLPEDVMLGAVVFGHEQMQTAIDAIHELVREGGKPEWDWQPAPK
DEALNARVTELAQPELLAAYQIRDKQARLTKLKEVYAATSAKLEEEAVAAGTVAADKATV
GNILFDLEAKIVRGQILNGEPRIDGRDTRTVRPIEIRTGVLPRTHGSALFTRGETQALVV
ATLGTKGDEQIIDALEGEYRERFMLHYNMPPFATGETGRVGSPKRREIGHGRLAKRALVA
CLPSADEFGYSIRVVSEITESNGSSSMASVCGGCLALMDAGVPMKAHVAGIAMGLILEGN
KFAVLTDILGDEDHLGDMDFKVAGTADGVTALQMDIKIQGITKEIMQVALAQAKEGRMHI
LGKMKDAVAGANTQLSEFAPRMITIKINPEKIRDVIGKGGSVIRALTEETGTTIDISDDG
VVTIASTNSEGMAEAKKRIENITAEIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISE
IVNERVKDINDYLKEGQQVKVKVIQTDEKGRVRLSAKALLNEAAAQADTPPQQ
Download sequence
Identical sequences A0A290YAA0 A1V2L2 A2S463 A3MI97 C4ATT5 Q62IN1
gi|124384993|ref|YP_001026732.1| gi|121601052|ref|YP_992465.1| WP_004186494.1.100104 WP_004186494.1.100727 WP_004186494.1.13925 WP_004186494.1.20531 WP_004186494.1.21442 WP_004186494.1.22329 WP_004186494.1.22625 WP_004186494.1.23385 WP_004186494.1.26445 WP_004186494.1.28453 WP_004186494.1.29148 WP_004186494.1.31831 WP_004186494.1.3251 WP_004186494.1.33419 WP_004186494.1.33543 WP_004186494.1.34747 WP_004186494.1.35757 WP_004186494.1.35878 WP_004186494.1.38946 WP_004186494.1.39349 WP_004186494.1.40191 WP_004186494.1.41477 WP_004186494.1.43899 WP_004186494.1.44540 WP_004186494.1.4810 WP_004186494.1.48313 WP_004186494.1.48407 WP_004186494.1.53977 WP_004186494.1.54892 WP_004186494.1.57679 WP_004186494.1.61073 WP_004186494.1.61588 WP_004186494.1.66594 WP_004186494.1.67393 WP_004186494.1.69508 WP_004186494.1.72545 WP_004186494.1.72798 WP_004186494.1.74675 WP_004186494.1.75230 WP_004186494.1.75861 WP_004186494.1.78557 WP_004186494.1.79653 WP_004186494.1.82283 WP_004186494.1.84063 WP_004186494.1.84480 WP_004186494.1.9236 WP_004186494.1.9281 WP_004186494.1.95952 WP_004186494.1.96660 WP_004186494.1.98066 YP_103438.1.87047 gi|126449416|ref|YP_001079983.1| 243160.BMA1834 320388.BMASAVP1_A1125 320389.BMA10247_0408 412022.BMA10229_A0742 gi|53725829|ref|YP_103438.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]