SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 320389.BMA10247_1787 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  320389.BMA10247_1787
Domain Number 1 Region: 42-116
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.97e-16
Family Cold shock DNA-binding domain-like 0.094
Further Details:      
 
Domain Number 2 Region: 125-233
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0000000144
Family RecO C-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 320389.BMA10247_1787
Sequence length 275
Comment (Burkholderia mallei NCTC 10247)
Sequence
MTDEADADLQPFAAPPATGAPAADKPARKPRRAAPRTSEFRIAEQPAFVLHSYPYRETSL
VIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKSELRTLTGAEWVGGMLP
LAGDALLCGFYANELLVKFCAREDPHPPLFQHYLVTLTRLAHGEPPVQVLRSFERVLLRE
TGYAMTLKRTVARRAVEPDKLYVFDPQRGVRDAGSDAPSHWPVIAGQTLLDMEEDDYHRA
QTVAQSKTLMRFLLNTYLGGTPLATRQILIDLQNL
Download sequence
Identical sequences A2S9Z7 C4AXF5 Q62LS7
gi|124384477|ref|YP_001028766.1| gi|126448568|ref|YP_001081326.1| 320388.BMASAVP1_A2464 320389.BMA10247_1787 412022.BMA10229_A2817 gi|121600755|ref|YP_993768.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]