SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 320483.AMF_586 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  320483.AMF_586
Domain Number 1 Region: 152-291
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 9.03e-34
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00011
Further Details:      
 
Domain Number 2 Region: 4-54
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000332
Family TS-N domain 0.0081
Further Details:      
 
Domain Number 3 Region: 56-147
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 0.000000000000196
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 320483.AMF_586
Sequence length 291
Comment (Anaplasma marginale Florida)
Sequence
MKVGVEAIRELRQITGAGLGDCKEALETCSGDMEKAKVYLREKGLSKAYKKSHRDAADGL
VAVRVEGDKGAILKLGSETDFVARNEKFRSLAAELVSSLLKHGAEDLSSFSASPYDGGSG
VSVADEVVNAAAVLGEHIVLSGIGFLELGGPGVIGSYIHGAVGEGIGRAGALVALEATTA
KTEALLEFARQLAMHIVAAKPESVSVETLSNDIVEREREIVAKQVEALGKPESVASKIVD
GRMQKFFEDMVLLEQTFIMDGSTKIRDLLHNKGQDLGCEVRIVAYRLFSVG
Download sequence
Identical sequences B9KIW9
gi|557625763|ref|YP_008786130.1| 320483.AMF_586 WP_010267861.1.11087 WP_010267861.1.19914 WP_010267861.1.23764 WP_010267861.1.60711 WP_010267861.1.77589 WP_010267861.1.83377 WP_010267861.1.83909 gi|222475271|ref|YP_002563687.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]