SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 32049.SYNPCC7002_A1678 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  32049.SYNPCC7002_A1678
Domain Number 1 Region: 101-182
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00000628
Family Integrin alpha N-terminal domain 0.0099
Further Details:      
 
Weak hits

Sequence:  32049.SYNPCC7002_A1678
Domain Number - Region: 224-283
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0497
Family C-terminal domain of PLC-beta 0.045
Further Details:      
 
Domain Number - Region: 48-104
Classification Level Classification E-value
Superfamily delta-Endotoxin (insectocide), N-terminal domain 0.0628
Family delta-Endotoxin (insectocide), N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 32049.SYNPCC7002_A1678
Sequence length 319
Comment (Synechococcus PCC 7002)
Sequence
MRQILEGIISLIEALITWPSLFFYIAIKYHKEFRAILNRLESAKFGDAEISLSKKQTEKA
IDKTLEEFSKDIMTPIIQSLAPNEASNTNKNRYLKNNNGEINTASFSVQIGDVDGDGRDE
FVISSMEGLYWCRVRIFKPILEFREQEIKTYFEMIGEICPVNFLEDVSDIDRDAYAEIIV
NEDNKSSGLPHAAGHRDRVVYKFRDGQLYEFSREEIPRLNTQFEMNKFAEKSFREKDKIM
NDIIDNLLSEFEENKDLIELIKESQNAWLIYREKQARIWSEIVKGGSMYAMIYCNHMARL
TDQRIDEMNNLIDREEGCF
Download sequence
Identical sequences B1XP74
WP_012307290.1.22074 WP_012307290.1.52632 WP_012307290.1.62705 32049.SYNPCC7002_A1678 gi|170078285|ref|YP_001734923.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]