SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 32049.SYNPCC7002_A2688 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  32049.SYNPCC7002_A2688
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily PUA domain-like 3.31e-56
Family Atu2648/PH1033-like 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 32049.SYNPCC7002_A2688
Sequence length 150
Comment (Synechococcus PCC 7002)
Sequence
MRYWLIKSEPSEYSLADLAADGTELWDGVRNYQARNFLQQMEKGDRLFFYHSNTKSPGIV
GLASVTQTNLVDPSQFNPESKYFDPKATSEKPRWYTVAVGYQETFAEIITLDQLKASFTP
EEFAVVRRGNRLSVMPVPETVAERLLAMVS
Download sequence
Identical sequences B1XLZ0
gi|170079281|ref|YP_001735919.1| 32049.SYNPCC7002_A2688 WP_012308282.1.22074 WP_012308282.1.52632 WP_012308282.1.62705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]