SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 32051.SynWH7803_0082 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  32051.SynWH7803_0082
Domain Number 1 Region: 208-315
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 2.3e-17
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.04
Further Details:      
 
Domain Number 2 Region: 2-202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000797
Family Extended AAA-ATPase domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 32051.SynWH7803_0082
Sequence length 326
Comment (Synechococcus WH 7803)
Sequence
MPIQLLWGDDSAALERAIQAVIDSALDPAWASVNLSRLDGSDSGQARQALEEARTPPFGS
GARVVLLQRSPFCNGCPSELADRFEASIDTIPDSTELLLCNPNKPDGRLRTTKALQKRVK
AGQAKELSFKLPAVWDGAGQRQLVERTASELKLSLEPKAVDALIDAIGSDSARLSMELQK
LALHAESTGSPHISATAVQSLIDGLSTNALQVGDALLAGDPGEAIALLDALLDGGEPALR
IVATLTGQIRGWLWVLLLEQQGERDVAVIAKAAGIGNPKRIYVMRKQLQGRSPERCLNLL
GRLLDVEAALKRGAQPGDAFRDGLLG
Download sequence
Identical sequences A5GHU3
gi|148238418|ref|YP_001223805.1| 32051.SynWH7803_0082 WP_011932016.1.60914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]