SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 32051.SynWH7803_0576 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  32051.SynWH7803_0576
Domain Number 1 Region: 5-79
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000036
Family RecO N-terminal domain-like 0.057
Further Details:      
 
Domain Number 2 Region: 82-247
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.00000000837
Family RecO C-terminal domain-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 32051.SynWH7803_0576
Sequence length 270
Comment (Synechococcus WH 7803)
Sequence
MSGDRRLQGLALKVGPLGEHDRLLTLLSDDVGVVRLAVPGARRPRSSLAAAVPLTCLDLQ
VVGRRGLARVRQLRVLRSYSGLGQRLDTLASAQALAELAIALVSSDDPVPGLLEAVLIHL
DRLERLSRTPGEEADLCLANVVQAGVHLLALGGYGLPLQACCRSGAALTPPIGQWEWRCS
VLPEEGLALGALAGARLQLNPSELALLQRLPRPDLPRRSNGELLGPRPVWLKLLALLECW
CRAHLPRPVRSLAMVRDCLSAAPLSDHEPT
Download sequence
Identical sequences A5GJ87
WP_011932488.1.60914 gi|148238912|ref|YP_001224299.1| 32051.SynWH7803_0576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]