SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 32051.SynWH7803_1346 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  32051.SynWH7803_1346
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily Globin-like 1.32e-46
Family Phycocyanin-like phycobilisome proteins 0.0000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 32051.SynWH7803_1346
Sequence length 174
Comment (Synechococcus WH 7803)
Sequence
MRDAITGLIGRYDQLGRYLDRSAIDRIESYLDESAIRLKAVELINREAAELVREASQRLF
QGDPELLLPGGNAYTTRRLAACLRDMDYFLRYASYALIAGDSTILNERVLNGLDDTYKSL
GVPTGPTVRSMVLLADVLCERLLEEGVPSKSLDLVRAPFEHMASGLAASDVRQR
Download sequence
Identical sequences A5GLF7
32051.SynWH7803_1346 WP_011933250.1.60914 gi|148239682|ref|YP_001225069.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]