SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 321332.CYB_1011 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  321332.CYB_1011
Domain Number - Region: 7-84
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0282
Family FCH domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 321332.CYB_1011
Sequence length 91
Comment (Cyanobacteria bacterium Yellowstone B-Prime)
Sequence
MAESKLRQLLRDLDVELQKTPGLDEKQRQHIATIRQEVEAVLAELGSRTESKQSQGHRDR
IGEALGLFETSHPNLTLILEQVIDTLAGMGL
Download sequence
Identical sequences Q2JMP8
gi|86608490|ref|YP_477252.1| WP_011432644.1.34384 321332.CYB_1011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]