SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 321332.CYB_1457 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  321332.CYB_1457
Domain Number 1 Region: 11-141
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-26
Family cAMP-binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 157-213
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000204
Family CAP C-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 321332.CYB_1457
Sequence length 235
Comment (Cyanobacteria bacterium Yellowstone B-Prime)
Sequence
MASDAPVALLSELKAVPMLAELSATSLQWLGSQVKLRDIPAGQALFMQDAWGSVVYLILA
GWAKVRRALRAQDSTKTLALLGPGAWVGEMAVLDEAPRSRDVLALTPLRVAGIPAATFKA
LMLQEPQLCYQLACSLSRRLRLANLQADLDQQSPPLRVVHTLVQLAEAFGEKTPQGMRIV
YPPPQDLADISQVSRETALAVLSRLQQQGVIQPLPEQQSLLLIQYAKLLEATRLL
Download sequence
Identical sequences Q2JLI3
321332.CYB_1457 WP_011433072.1.34384 gi|86608925|ref|YP_477687.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]