SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI101377 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI101377
Domain Number - Region: 60-103
Classification Level Classification E-value
Superfamily Prefoldin 0.0994
Family Prefoldin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI101377
Sequence length 143
Comment (Physcomitrella patens)
Sequence
MRIDGTILEKVLFLFIGEIAVEIDDSSDFSRGRYFKGGMSAFERNQEELIVEGRLEASIE
DVSEWMSQQQHQLELCDAQILKLEAQVHELGEYNEDLSNQLRKESMDGLEEEEDLNLEPE
LVESTLDNAANDQLSRPEEIVTM
Download sequence
Identical sequences A9U3J4
XP_001785425.1.60028 jgi|Phypa1_1|101377|fgenesh1_pg.scaffold_470000007 3218.JGI101377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]