SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI104499 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI104499
Domain Number 1 Region: 80-155
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.09e-32
Family Skp1 dimerisation domain-like 0.0000239
Further Details:      
 
Domain Number 2 Region: 5-65
Classification Level Classification E-value
Superfamily POZ domain 4.71e-21
Family BTB/POZ domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI104499
Sequence length 157
Comment (Physcomitrella patens)
Sequence
MAEKRVKLKSSDDEMFEVDEAVAFESQAVKNMIEDTGIDAPIPLPNVSSKILAKVIEYCK
YHVENQKPSDDKQATPEEEIKAWDADFVKVDQATLFDLILAANYLNIKNLLDLTCQTVAD
MIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
Download sequence
Identical sequences A9RG78
3218.JGI104499 PP1S7_342V6.1 jgi|Phypa1_1|104499|estExt_fgenesh1_pm.C_70040 XP_001753031.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]