SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI119035 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI119035
Domain Number 1 Region: 103-223
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.98e-33
Family cAMP-binding domain 0.00022
Further Details:      
 
Domain Number 2 Region: 2-100
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.46e-28
Family cAMP-binding domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI119035
Sequence length 238
Comment (Physcomitrella patens)
Sequence
MELCQVIDAVEEEKHKAQDIIIQQSQLGDTFYFIEGGSCDVYIKQSENANPVCVASYSAG
DSFGELALLYNAPRAATVKATTDCILWAMDRGTFQQILMTSTSQKRNLYEEFLASVPLLK
TLDAYERSAIADVLEPEYYNPGQSIIVEDTPGDKFYFLEEGTAEAKTKGQVLMKYKSGDY
FGELALLNNEPRAASVVTTSNCKVVFIERESFKRLLGKLEDILHRKKLEYATVAAAIS
Download sequence
Identical sequences A9RTB2
jgi|Phypa1_1|119035|e_gw1.27.77.1 3218.JGI119035 XP_001757400.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]