SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI122031 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI122031
Domain Number 1 Region: 117-263
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.49e-19
Family AlaX-like 0.055
Further Details:      
 
Domain Number 2 Region: 17-99
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000117
Family AlaX-M N-terminal domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI122031
Sequence length 270
Comment (Physcomitrella patens)
Sequence
MGVPGTSHSCGDGALPPTNLAYFDDMRKLHSNAIVAGVITEGERLAVVLDQTILHPQGGG
QPFDTGSIEAVDGTIKFCVTDVRTKSGVVYHYGNYHENRVMEATGFEPGHEVKISVDGAR
RTLNSRLHSAGHLLDACMSNIGLGSLEPGKGYHFPDGPFVEYKGTIPSSDLENKRDALES
EANHLIALGGQVRATVASYSEAAALCGGRLPDYIAKESCPRIICLGENLGCPCGGTHVLA
ISEIGEIKVSQIRVRKGVTKVYYNLPKSEA
Download sequence
Identical sequences A9RZW8
XP_001759601.1.60028 jgi|Phypa1_1|122031|e_gw1.38.269.1 3218.JGI122031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]