SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI125607 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI125607
Domain Number 1 Region: 127-280
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.51e-35
Family Pentapeptide repeats 0.00053
Further Details:      
 
Domain Number 2 Region: 10-108
Classification Level Classification E-value
Superfamily POZ domain 2.69e-16
Family Tetramerization domain of potassium channels 0.011
Further Details:      
 
Weak hits

Sequence:  3218.JGI125607
Domain Number - Region: 289-315
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0118
Family Pentapeptide repeats 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI125607
Sequence length 351
Comment (Physcomitrella patens)
Sequence
MGSPTSSLQIRLDIGGVKFTTTASTLARRNANSVLAAVANDCLQKSQTPGYECETVVFDR
DGTHFKHILIWLRDGVVTRGLKTSVYLEILREAEYYTLPGLRKSVKRILGTYDDKVPEDV
KSAAQTPDLRRLDVIRFTHCGLKLRGVNLSGLDLSNLDLSGGEFQYARLYNTNFENCDLR
DANLEYCDAGGANFRNANLRFCNCTGAKMVGAVLDGADMFLAKFYSARLKNASLRKTIAV
RAEFNDANLSRSNLSGAYMSGACLKNANLTDANLSDVEFSFSKHWKAGRADFQYATLTGA
NFHHAKLEAYFLRNARDYENTINLDESIRNKLEPRLPWMLGRNWFKVPASK
Download sequence
Identical sequences A9S7Y1
jgi|Phypa1_1|125607|e_gw1.55.229.1 XP_001762534.1.60028 3218.JGI125607 PP1S55_43V6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]