SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI128346 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI128346
Domain Number 1 Region: 22-93
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.06e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI128346
Sequence length 118
Comment (Physcomitrella patens)
Sequence
RGKKVKNKEQPPKQGFIHVRARRGQATNSHSLAERARREKISNRMKFLQALVPGCSEVTG
KAVMLEEIINYVKSLQRQIEFLSMKLAAVDPRLDTNVEGLLKMEVCAVRLVSVPMGVQ
Download sequence
Identical sequences A9SE06
3218.JGI128346 jgi|Phypa1_1|128346|e_gw1.69.179.1 XP_001764562.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]