SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI133145 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI133145
Domain Number 1 Region: 145-249
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.53e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI133145
Sequence length 345
Comment (Physcomitrella patens)
Sequence
MDSLERDEDTKEVAPELEIEVTGKKPKHKGKHDKPKPWDTDDIEHWKLEKFDPSFNEGGM
LEESSFATLFPAYREKYLRETWPVITQALKEHGIKAVLDLVKGSMTVSTTRKTRDPYIIM
KARDLMKLLSRSVPAPQALKILEDDMQCDIIKIGNLIRNKERFVKRRQRLLGPNGATLKA
LELLTGCYVLVQGSTVSAMGPWKGLKAVRRVVEDCIKNVHPIYHIKALMIKRELAKDPEL
KDQNWDRFLPKFKKKNVKAKKVSKDKEKKDYTPFPPPQQPSKVDLQLESGEYFLSAEMKA
AKKWEAKKEKQSEKAVENKRKREAAFIAPKVVELHPYEFLFFCVE
Download sequence
Identical sequences A9SPQ0
3218.JGI133145 XP_001768278.1.60028 jgi|Phypa1_1|133145|e_gw1.101.47.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]