SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI154424 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI154424
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily POZ domain 1.23e-29
Family BTB/POZ domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI154424
Sequence length 99
Comment (Physcomitrella patens)
Sequence
MLSKSQTIKLVSAEGFEFIIDRKAAVVSNTLRNMLSSSGNFTETELGEVKFPEISTPILE
KVCQYFYWSLQFSSGKETEFHIEPEITLDLMMAANYLHT
Download sequence
Identical sequences A9U1S0
3218.JGI154424 jgi|Phypa1_1|154424|e_gw1.424.15.1 XP_001784798.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]