SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI159081 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI159081
Domain Number - Region: 2-68
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00889
Family beta-sandwich domain of Sec23/24 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI159081
Sequence length 250
Comment (Physcomitrella patens)
Sequence
MQAPPADQQWQGTPQASYPYAPQMWNAGQQSAMAGMQQYPGAGYTGYAIQPSPGQQSFQS
AYQGHPASNDLSRYGSGTGPGDNFGSQYLNSRGSAYGQSTSQKYTGSSKPLKSPDTLFDD
LVDLRSINAKFKGTSLANKTPNTSKARLGTNATLFHGTGNVRAAYKLLIALSLPLSKRGW
NTVWGFEVCQFVRMQGWLEIVRSTQVMEVWDVVRRTWSTATVWIVNSSRQHDYETVFRGQ
SLCARKYFQI
Download sequence
Identical sequences XP_001753542.1.60028 jgi|Phypa1_1|159081|estExt_fgenesh1_pg.C_90142 3218.JGI159081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]